PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005413m
Common NameEUTSA_v10005413mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26525.7 Da    PI: 8.0635
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005413mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.41.6e-17948140
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                     kri+nks rqvtfskRrng++ KA  LS+LC+  +av+++
  Thhalv10005413m  9 KRIDNKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVV 48
                     79*********************************98753 PP

2K-box26.23.3e-101511993684
            K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                       +l   ++++ s+  L ++e+qLe++++  R++K+el++e +++lq+k 
  Thhalv10005413m 151 SNLEEPNVDNVSVDSLISVEDQLETAMSVTRARKTELMMEFVKTLQEKL 199
                      555556778999**********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.1E-18148IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.731148IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-21161IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-17323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-161048IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-173859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.219129216IPR002487Transcription factor, K-box
PfamPF014864.9E-6157198IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRRKVEIKR IDNKSSRQVT FSKRRNGLIE KARQLSILCE SSIAVLVVFG LRQALQLLLR  60
RQIWFIYPIL RCTSGRFVDR LIGVNGDFDQ DSLVEIWMPH CPLQLLFQNV FMTKIIDRYD  120
IQHADDLKTL ELAEKTRNYL PHKELLELVQ SNLEEPNVDN VSVDSLISVE DQLETAMSVT  180
RARKTELMME FVKTLQEKLG KNTALVTDDE RALSPASNSG NNPPETLSLL K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527771e-144AK352777.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-07-K22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394082.11e-170hypothetical protein EUTSA_v10005413mg
SwissprotQ9FPN72e-74AGL31_ARATH; Agamous-like MADS-box protein AGL31
TrEMBLV4KVF71e-170V4KVF7_EUTSA; Uncharacterized protein
STRINGAT5G65060.13e-77(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65060.18e-81MIKC_MADS family protein